SCOPe 2.05: Domain d1v14c_: 1v14 C:

Lineage for d1v14c_ (1v14 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein DNase domain of colicin E9 [54064] (1 species)

7. Species Escherichia coli [TaxId:562] [54065] (15 PDB entries)
   Uniprot P09883 456-581

8. Domain d1v14c_: 1v14 C: [108234]
   complexed with mg; mutant

Details for d1v14c_

PDB Entry: 1v14, 2.9 Å

PDB Description: crystal structure of the colicin e9, mutant his103ala, in complex with mg+2 and dsdna (resolution 2.9a)

PDB Compounds: (C:) colicin e9

SCOPe Domain Sequences for d1v14c_:

Sequence; same for both SEQRES and ATOM records:

>d1v14c_ d.4.1.1 (C:) DNase domain of colicin E9 {Escherichia coli [TaxId: 562]}
eskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweev
skdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnirv
ttpkrhidihrg

Timeline for d1v14c_:

• d1v14c_ first appeared in SCOP 1.69
  
• d1v14c_ appears in SCOPe 2.04
  
• d1v14c_ appears in SCOPe 2.06
  
• d1v14c_ appears in the current release, SCOPe 2.08