![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (6 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein Laccase [49557] (5 species) consists of three domains of this fold |
![]() | Species Rigidoporus lignosus [TaxId:219653] [110102] (1 PDB entry) |
![]() | Domain d1v10a1: 1v10 A:1-136 [108224] |
PDB Entry: 1v10 (more details), 1.7 Å
SCOP Domain Sequences for d1v10a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus} atvaldlhilnanldpdgtgarsavtaegttiaplitgniddrfqinvidqltdanmrra tsihwhgffqagttemdgpafvnqcpiipnesfvydfvvpgqagtywyhshlstqycdgl rgafvvydpndphlsl
Timeline for d1v10a1: