Lineage for d1uzrc_ (1uzr C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441421Family a.25.1.2: Ribonucleotide reductase-like [47253] (7 proteins)
  6. 441523Protein Ribonucleotide reductase R2 [47257] (8 species)
  7. 441602Species Mycobacterium tuberculosis [TaxId:1773] [109787] (1 PDB entry)
  8. 441605Domain d1uzrc_: 1uzr C: [108180]

Details for d1uzrc_

PDB Entry: 1uzr (more details), 2.2 Å

PDB Description: crystal structure of the class ib ribonucleotide reductase r2f-2 subunit from mycobacterium tuberculosis

SCOP Domain Sequences for d1uzrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uzrc_ a.25.1.2 (C:) Ribonucleotide reductase R2 {Mycobacterium tuberculosis}
drvsainwnrlqdekdaevwdrltgnfwlpekvpvsndipswgtltagekqltmrvftgl
tmldtiqgtvgavslipdaltpheeavltniafmesvhaksysqifstlcstaeiddafr
wseenrnlqrkaeivlqsyrgdeplkrkvastllesflfysgfylpmywssrakltntad
mirliirdeavhgyyigykfqrglalvddvtraelkdytyellfelydneveytqdlyde
vgltedvkkflrynankalmnlgyealfprdetdvnpailsal

SCOP Domain Coordinates for d1uzrc_:

Click to download the PDB-style file with coordinates for d1uzrc_.
(The format of our PDB-style files is described here.)

Timeline for d1uzrc_: