SCOPe 2.05: Domain d1uzrb_: 1uzr B:

Lineage for d1uzrb_ (1uzr B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109787] (1 PDB entry)
   Uniprot Q50549 10-291

8. Domain d1uzrb_: 1uzr B: [108179]
   complexed with cit, fe, gol

Details for d1uzrb_

PDB Entry: 1uzr, 2.2 Å

PDB Description: crystal structure of the class ib ribonucleotide reductase r2f-2 subunit from mycobacterium tuberculosis

PDB Compounds: (B:) ribonucleotide reductase r2-2 small subunit

SCOPe Domain Sequences for d1uzrb_:

Sequence; same for both SEQRES and ATOM records:

>d1uzrb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Mycobacterium tuberculosis [TaxId: 1773]}
drvsainwnrlqdekdaevwdrltgnfwlpekvpvsndipswgtltagekqltmrvftgl
tmldtiqgtvgavslipdaltpheeavltniafmesvhaksysqifstlcstaeiddafr
wseenrnlqrkaeivlqsyrgdeplkrkvastllesflfysgfylpmywssrakltntad
mirliirdeavhgyyigykfqrglalvddvtraelkdytyellfelydneveytqdlyde
vgltedvkkflrynankalmnlgyealfprdetdvnpailsalspnad

Timeline for d1uzrb_:

• d1uzrb_ first appeared in SCOP 1.69
  
• d1uzrb_ appears in SCOPe 2.04
  
• d1uzrb_ appears in SCOPe 2.06
  
• d1uzrb_ appears in the current release, SCOPe 2.08