Lineage for d1uz8l2 (1uz8 L:107-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656524Domain d1uz8l2: 1uz8 L:107-210 [108173]
    Other proteins in same PDB: d1uz8a1, d1uz8b1, d1uz8b2, d1uz8h1, d1uz8h2, d1uz8l1
    MQ P03976 P01837 #
    natural chimera
    complexed with fuc, gal, mag

Details for d1uz8l2

PDB Entry: 1uz8 (more details), 1.8 Å

PDB Description: anti-lewis x fab fragment in complex with lewis x
PDB Compounds: (L:) igg fab (igg3,kappa) light chain 291-2g3-a

SCOP Domain Sequences for d1uz8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uz8l2 b.1.1.2 (L:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1uz8l2:

Click to download the PDB-style file with coordinates for d1uz8l2.
(The format of our PDB-style files is described here.)

Timeline for d1uz8l2: