SCOP 1.75: Domain d1uz8h2: 1uz8 H:114-212

Lineage for d1uz8h2 (1uz8 H:114-212)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
   Uniprot P22436 # GC3_MOUSE (P22436) Ig gamma-3 chain C region

8. Domain d1uz8h2: 1uz8 H:114-212 [108171]
   Other proteins in same PDB: d1uz8a1, d1uz8a2, d1uz8b1, d1uz8h1, d1uz8l1, d1uz8l2
   MQ P01811 P22436 #
   natural chimera
   complexed with fuc, gal, mag
   MQ P01811 P22436 # ! natural chimera

Details for d1uz8h2

PDB Entry: 1uz8, 1.8 Å

PDB Description: anti-lewis x fab fragment in complex with lewis x

PDB Compounds: (H:) igg fab (igg3,kappa) heavy chain 291-2g3-a

SCOP Domain Sequences for d1uz8h2:

Sequence; same for both SEQRES and ATOM records:

>d1uz8h2 b.1.1.2 (H:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpggssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgfysls
slvtvpsstwpsqtvicnvahpasktelikriep

Timeline for d1uz8h2:

• d1uz8h2 first appeared in SCOP 1.69
  
• d1uz8h2 appears in SCOP 1.73
  
• d1uz8h2 appears in SCOPe 2.01
  
• d1uz8h2 appears in the current release, SCOPe 2.08