Lineage for d1uz6w1 (1uz6 W:1-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2021955Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (59 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2022036Domain d1uz6w1: 1uz6 W:1-113 [108164]
    Other proteins in same PDB: d1uz6e1, d1uz6e2, d1uz6f2, d1uz6h2, d1uz6l1, d1uz6l2, d1uz6m1, d1uz6m2, d1uz6p2, d1uz6v1, d1uz6v2, d1uz6w2
    MQ P01811 P22436 # ! natural chimera
    complexed with so4

Details for d1uz6w1

PDB Entry: 1uz6 (more details), 2.05 Å

PDB Description: anti-lewis x fab fragment uncomplexed
PDB Compounds: (W:) igg fab (igg3, kappa) heavy chain 291-2g3-a

SCOPe Domain Sequences for d1uz6w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uz6w1 b.1.1.1 (W:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvss

SCOPe Domain Coordinates for d1uz6w1:

Click to download the PDB-style file with coordinates for d1uz6w1.
(The format of our PDB-style files is described here.)

Timeline for d1uz6w1: