Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries) Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10 |
Domain d1uz6w1: 1uz6 W:1-113 [108164] Other proteins in same PDB: d1uz6e1, d1uz6e2, d1uz6f2, d1uz6h2, d1uz6l1, d1uz6l2, d1uz6m1, d1uz6m2, d1uz6p2, d1uz6v1, d1uz6v2, d1uz6w2 MQ P01811 P22436 # ! natural chimera complexed with so4 |
PDB Entry: 1uz6 (more details), 2.05 Å
SCOPe Domain Sequences for d1uz6w1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uz6w1 b.1.1.1 (W:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvss
Timeline for d1uz6w1: