SCOP 1.75: Domain d1uz6p1: 1uz6 P:1-113

Lineage for d1uz6p1 (1uz6 P:1-113)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (54 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1uz6p1: 1uz6 P:1-113 [108160]
   Other proteins in same PDB: d1uz6e1, d1uz6e2, d1uz6f2, d1uz6h2, d1uz6l1, d1uz6l2, d1uz6m1, d1uz6m2, d1uz6p2, d1uz6v1, d1uz6v2, d1uz6w2
   MQ P01811 P22436 # ! natural chimera

Details for d1uz6p1

PDB Entry: 1uz6, 2.05 Å

PDB Description: anti-lewis x fab fragment uncomplexed

PDB Compounds: (P:) igg fab (igg3,kappa) heavy chain 291-2g3-a

SCOP Domain Sequences for d1uz6p1:

Sequence; same for both SEQRES and ATOM records:

>d1uz6p1 b.1.1.1 (P:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evkllesggglvqpggsqklscaasgfdfsgywmswvrqapgkglewigeinpdsstiny
tpslkdkfiisrdnakntlylqmskvrsedtalyycaretgtrfdywgqgttltvss

Timeline for d1uz6p1:

• d1uz6p1 first appeared in SCOP 1.69
  
• d1uz6p1 appears in SCOP 1.73
  
• d1uz6p1 appears in SCOPe 2.01
  
• d1uz6p1 appears in the current release, SCOPe 2.08