SCOP 1.73: Domain d1uz6e1: 1uz6 E:1-106

Lineage for d1uz6e1 (1uz6 E:1-106)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d1uz6e1: 1uz6 E:1-106 [108150]
   Other proteins in same PDB: d1uz6e2, d1uz6f1, d1uz6f2, d1uz6h1, d1uz6h2, d1uz6l2, d1uz6m2, d1uz6p1, d1uz6p2, d1uz6v2, d1uz6w1, d1uz6w2

Details for d1uz6e1

PDB Entry: 1uz6, 2.05 Å

PDB Description: anti-lewis x fab fragment uncomplexed

PDB Compounds: (E:) igg fab (igg3,kappa) light chain 291-2g3-a

SCOP Domain Sequences for d1uz6e1:

Sequence; same for both SEQRES and ATOM records:

>d1uz6e1 b.1.1.1 (E:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
divmtqaafsnpvtlgtsasiscrssksllysngitylywylqkpgqspqlliyqmsnla
sgvpdrfsssgsgtdftlrisrveaedvgvyycaqnlevpwtfgggtklei

Timeline for d1uz6e1:

• d1uz6e1 first appeared in SCOP 1.69
  
• d1uz6e1 appears in SCOP 1.71
  
• d1uz6e1 appears in SCOP 1.75
  
• d1uz6e1 appears in the current release, SCOPe 2.08