Lineage for d1uxeb_ (1uxe B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793517Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 793518Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families) (S)
  5. 793519Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein)
  6. 793520Protein Adenovirus fiber protein "knob" domain [49837] (7 species)
  7. 793565Species Human adenovirus type 37 [TaxId:52275] [110136] (4 PDB entries)
    Uniprot Q64823 182-365
    Uniprot Q64823 181-365
    Uniprot Q64823 182-365 ! Uniprot Q64823 181-365
  8. 793574Domain d1uxeb_: 1uxe B: [108098]

Details for d1uxeb_

PDB Entry: 1uxe (more details), 2 Å

PDB Description: adenovirus ad37 fibre head
PDB Compounds: (B:) fiber protein

SCOP Domain Sequences for d1uxeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxeb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus type 37 [TaxId: 52275]}
trtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpkik
sftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskky
ardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsyi
aqe

SCOP Domain Coordinates for d1uxeb_:

Click to download the PDB-style file with coordinates for d1uxeb_.
(The format of our PDB-style files is described here.)

Timeline for d1uxeb_: