Lineage for d1uupc2 (1uup C:3108-3221)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499977Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 499978Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 500044Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 500045Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
  8. 500054Domain d1uupc2: 1uup C:3108-3221 [108055]
    Other proteins in same PDB: d1uupa1, d1uupb1, d1uupc1, d1uupd1

Details for d1uupc2

PDB Entry: 1uup (more details), 2.6 Å

PDB Description: crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).

SCOP Domain Sequences for d1uupc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uupc2 d.15.6.1 (C:3108-3221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk

SCOP Domain Coordinates for d1uupc2:

Click to download the PDB-style file with coordinates for d1uupc2.
(The format of our PDB-style files is described here.)

Timeline for d1uupc2: