Lineage for d1uupc1 (1uup C:3001-3107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314261Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1314342Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 1314343Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
    Uniprot P08095
  8. 1314352Domain d1uupc1: 1uup C:3001-3107 [108054]
    Other proteins in same PDB: d1uupa2, d1uupb2, d1uupc2, d1uupd2
    complexed with zn

Details for d1uupc1

PDB Entry: 1uup (more details), 2.6 Å

PDB Description: crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).
PDB Compounds: (C:) exotoxin type a

SCOPe Domain Sequences for d1uupc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uupc1 b.40.2.2 (C:3001-3107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOPe Domain Coordinates for d1uupc1:

Click to download the PDB-style file with coordinates for d1uupc1.
(The format of our PDB-style files is described here.)

Timeline for d1uupc1: