![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
![]() | Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries) Uniprot P08095 |
![]() | Domain d1uupa1: 1uup A:1001-1107 [108050] Other proteins in same PDB: d1uupa2, d1uupb2, d1uupc2, d1uupd2 complexed with zn |
PDB Entry: 1uup (more details), 2.6 Å
SCOPe Domain Sequences for d1uupa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uupa1 b.40.2.2 (A:1001-1107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]} qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe
Timeline for d1uupa1: