Lineage for d1ut2e_ (1ut2 E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040841Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 2040842Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 2040843Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 2040882Domain d1ut2e_: 1ut2 E: [108024]
    complexed with so4

Details for d1ut2e_

PDB Entry: 1ut2 (more details), 3.3 Å

PDB Description: afae-3 adhesin from escherichia coli
PDB Compounds: (E:) afimbrial adhesin afa-III

SCOPe Domain Sequences for d1ut2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ut2e_ b.2.3.6 (E:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk
adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq
qtntppgnytltltggywa

SCOPe Domain Coordinates for d1ut2e_:

Click to download the PDB-style file with coordinates for d1ut2e_.
(The format of our PDB-style files is described here.)

Timeline for d1ut2e_: