SCOPe 2.08: Domain d1urqb_: 1urq B:

Lineage for d1urqb_ (1urq B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Syntaxin 1A [88908] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
   Uniprot P32851 196-259
   a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B

8. Domain d1urqb_: 1urq B: [107995]
   Other proteins in same PDB: d1urqa_, d1urqc_, d1urqd1, d1urqd2

Details for d1urqb_

PDB Entry: 1urq, 2 Å

PDB Description: crystal structure of neuronal q-snares in complex with r-snare motif of tomosyn

PDB Compounds: (B:) syntaxin 1a

SCOPe Domain Sequences for d1urqb_:

Sequence; same for both SEQRES and ATOM records:

>d1urqb_ h.1.15.1 (B:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
etrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsdtkkav
kyqs

Timeline for d1urqb_:

• d1urqb_ first appeared in SCOP 1.69
  
• d1urqb_ appears in SCOPe 2.07