Lineage for d1uowa1 (1uow A:271-419)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045249Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2045274Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2045293Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (9 PDB entries)
    Uniprot P21707 271-419 ! Uniprot P21707 271-419
  8. 2045295Domain d1uowa1: 1uow A:271-419 [107975]
    Other proteins in same PDB: d1uowa2
    complexed with act, ca, gol

Details for d1uowa1

PDB Entry: 1uow (more details), 1.04 Å

PDB Description: calcium binding domain c2b
PDB Compounds: (A:) Synaptotagmin I

SCOPe Domain Sequences for d1uowa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uowa1 b.7.1.2 (A:271-419) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamlav

SCOPe Domain Coordinates for d1uowa1:

Click to download the PDB-style file with coordinates for d1uowa1.
(The format of our PDB-style files is described here.)

Timeline for d1uowa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uowa2