Lineage for d1umxl_ (1umx L:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579766Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2579767Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2579768Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2579769Protein L (light) subunit [81477] (3 species)
  7. 2579770Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries)
    Uniprot P02954
  8. 2579820Domain d1umxl_: 1umx L: [107963]
    Other proteins in same PDB: d1umxh1, d1umxh2, d1umxm_
    complexed with bcl, bpb, fe, lda, po4, spn, u10; mutant

Details for d1umxl_

PDB Entry: 1umx (more details), 2.8 Å

PDB Description: photosynthetic reaction center mutant with arg m267 replaced with leu (chain m, r267l)
PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d1umxl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umxl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d1umxl_:

Click to download the PDB-style file with coordinates for d1umxl_.
(The format of our PDB-style files is described here.)

Timeline for d1umxl_: