SCOPe 2.05: Domain d1umxh1: 1umx H:36-250

Lineage for d1umxh1 (1umx H:36-250)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d1umxh1: 1umx H:36-250 [107961]
   Other proteins in same PDB: d1umxh2, d1umxl_, d1umxm_
   complexed with bcl, bpb, fe, lda, po4, spn, u10; mutant

Details for d1umxh1

PDB Entry: 1umx, 2.8 Å

PDB Description: photosynthetic reaction center mutant with arg m267 replaced with leu (chain m, r267l)

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1umxh1:

Sequence; same for both SEQRES and ATOM records:

>d1umxh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d1umxh1:

• d1umxh1 first appeared in SCOP 1.69
  
• d1umxh1 appears in SCOPe 2.04
  
• d1umxh1 appears in SCOPe 2.06
  
• d1umxh1 appears in the current release, SCOPe 2.08