Lineage for d1umxh1 (1umx H:36-250)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464185Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 464186Superfamily b.41.1: PRC-barrel domain [50346] (3 families) (S)
  5. 464187Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 464188Protein Photosynthetic reaction centre [50348] (3 species)
  7. 464189Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries)
  8. 464223Domain d1umxh1: 1umx H:36-250 [107961]
    Other proteins in same PDB: d1umxh2, d1umxl_, d1umxm_

Details for d1umxh1

PDB Entry: 1umx (more details), 2.8 Å

PDB Description: photosynthetic reaction center mutant with arg m267 replaced with leu (chain m, r267l)
PDB Compounds: (H:)

SCOP Domain Sequences for d1umxh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umxh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOP Domain Coordinates for d1umxh1:

Click to download the PDB-style file with coordinates for d1umxh1.
(The format of our PDB-style files is described here.)

Timeline for d1umxh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1umxh2