Lineage for d1umob_ (1umo B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 530526Protein Cytoglobin [109626] (1 species)
  7. 530527Species Human (Homo sapiens) [TaxId:9606] [109627] (6 PDB entries)
  8. 530537Domain d1umob_: 1umo B: [107960]
    complexed with hem; mutant

Details for d1umob_

PDB Entry: 1umo (more details), 2.59 Å

PDB Description: the crystal structure of cytoglobin: the fourth globin type discovered in man

SCOP Domain Sequences for d1umob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umob_ a.1.1.2 (B:) Cytoglobin {Human (Homo sapiens)}
elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgw

SCOP Domain Coordinates for d1umob_:

Click to download the PDB-style file with coordinates for d1umob_.
(The format of our PDB-style files is described here.)

Timeline for d1umob_: