SCOPe 2.02: Domain d1ulje1: 1ulj E:17-170

Lineage for d1ulje1 (1ulj E:17-170)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (4 families)
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
Protein Biphenyl dioxygenase large subunit BphA1, N-terminal domain [110156] (1 species)
Species Rhodococcus sp. RHA1 [TaxId:101510] [110157] (2 PDB entries)
Uniprot Q53122 17-451
Domain d1ulje1: 1ulj E:17-170 [107936]
Other proteins in same PDB: d1ulja2, d1uljb_, d1uljc2, d1uljd_, d1ulje2, d1uljf_
complexed with bnl, fe2, fes

Details for d1ulje1

PDB Entry: 1ulj (more details), 2.6 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) in complex with the substrate

PDB Compounds: (E:) biphenyl dioxygenase large subunit

SCOPe Domain Sequences for d1ulje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulje1 b.33.1.2 (E:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. RHA1 [TaxId: 101510]}
wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym
gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf
eeqafpglrkedwgplqarvetykglifanwdad

SCOPe Domain Coordinates for d1ulje1:

Click to download the PDB-style file with coordinates for d1ulje1.
(The format of our PDB-style files is described here.)

Timeline for d1ulje1: