Lineage for d1uljc2 (1ulj C:171-451)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733462Superfamily d.129.3: Bet v1-like [55961] (7 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 733518Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 733522Protein Biphenyl dioxygenase large subunit BphA1, C-terminal domain [111166] (1 species)
  7. 733523Species Rhodococcus sp. (strain RHA1) [TaxId:101510] [111167] (2 PDB entries)
  8. 733528Domain d1uljc2: 1ulj C:171-451 [107934]
    Other proteins in same PDB: d1ulja1, d1uljb_, d1uljc1, d1uljd_, d1ulje1, d1uljf_

Details for d1uljc2

PDB Entry: 1ulj (more details), 2.6 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) in complex with the substrate
PDB Compounds: (C:) biphenyl dioxygenase large subunit

SCOP Domain Sequences for d1uljc2:

Sequence, based on SEQRES records: (download)

>d1uljc2 d.129.3.3 (C:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. (strain RHA1) [TaxId: 101510]}
apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh
lsgilaglpdgvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqg
paaekaserlgstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvda
dapeemkeeyrqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtds
dnpdypgtisyvyseeaarglytqwvrmmtspdwaaldatr

Sequence, based on observed residues (ATOM records): (download)

>d1uljc2 d.129.3.3 (C:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. (strain RHA1) [TaxId: 101510]}
apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh
lsgilagltegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserlgs
tergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeeyrq
qtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtisyv
yseeaarglytqwvrmmtspdwaaldatr

SCOP Domain Coordinates for d1uljc2:

Click to download the PDB-style file with coordinates for d1uljc2.
(The format of our PDB-style files is described here.)

Timeline for d1uljc2: