![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
![]() | Protein Biphenyl dioxygenase large subunit BphA1, C-terminal domain [111166] (1 species) |
![]() | Species Rhodococcus sp. RHA1 [TaxId:101510] [111167] (2 PDB entries) Uniprot Q53122 17-451 |
![]() | Domain d1ulic2: 1uli C:171-451 [107925] Other proteins in same PDB: d1ulia1, d1ulib_, d1ulic1, d1ulid_, d1ulie1, d1ulif_ complexed with fe2, fes |
PDB Entry: 1uli (more details), 2.2 Å
SCOPe Domain Sequences for d1ulic2:
Sequence, based on SEQRES records: (download)
>d1ulic2 d.129.3.3 (C:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. RHA1 [TaxId: 101510]} apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh lsgilaglpdgvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqg paaekaserlgstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvda dapeemkeeyrqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtds dnpdypgtisyvyseeaarglytqwvrmmtspdwaaldatr
>d1ulic2 d.129.3.3 (C:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. RHA1 [TaxId: 101510]} apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh lsgilagltegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserlgs tergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeeyrq qtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtisyv yseeaarglytqwvrmmtspdwaaldatr
Timeline for d1ulic2: