![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (2 families) ![]() |
![]() | Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
![]() | Protein Biphenyl dioxygenase large subunit BphA1, N-terminal domain [110156] (1 species) |
![]() | Species Rhodococcus sp. (strain RHA1) [TaxId:101510] [110157] (2 PDB entries) |
![]() | Domain d1ulic1: 1uli C:17-170 [107924] Other proteins in same PDB: d1ulia2, d1ulib_, d1ulic2, d1ulid_, d1ulie2, d1ulif_ |
PDB Entry: 1uli (more details), 2.2 Å
SCOP Domain Sequences for d1ulic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulic1 b.33.1.2 (C:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf eeqafpglrkedwgplqarvetykglifanwdad
Timeline for d1ulic1: