SCOP 1.71: Domain d1ulic1: 1uli C:17-170

Lineage for d1ulic1 (1uli C:17-170)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (2 families)
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (2 proteins)
Protein Biphenyl dioxygenase large subunit BphA1, N-terminal domain [110156] (1 species)
Species Rhodococcus sp. strain RHA1 [TaxId:101510] [110157] (2 PDB entries)
Domain d1ulic1: 1uli C:17-170 [107924]
Other proteins in same PDB: d1ulia2, d1ulib_, d1ulic2, d1ulid_, d1ulie2, d1ulif_

Details for d1ulic1

PDB Entry: 1uli (more details), 2.2 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) derived from Rhodococcus sp. strain RHA1

SCOP Domain Sequences for d1ulic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulic1 b.33.1.2 (C:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. strain RHA1}
wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym
gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf
eeqafpglrkedwgplqarvetykglifanwdad

SCOP Domain Coordinates for d1ulic1:

Click to download the PDB-style file with coordinates for d1ulic1.
(The format of our PDB-style files is described here.)

Timeline for d1ulic1: