SCOPe 2.08: Domain d1ulia1: 1uli A:17-170

Lineage for d1ulia1 (1uli A:17-170)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (4 families)
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
Protein Biphenyl dioxygenase large subunit BphA1, N-terminal domain [110156] (1 species)
Species Rhodococcus sp. RHA1 [TaxId:101510] [110157] (2 PDB entries)
Uniprot Q53122 17-451
Domain d1ulia1: 1uli A:17-170 [107921]
Other proteins in same PDB: d1ulia2, d1ulib_, d1ulic2, d1ulid_, d1ulie2, d1ulif_
complexed with fe2, fes

Details for d1ulia1

PDB Entry: 1uli (more details), 2.2 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) derived from Rhodococcus sp. strain RHA1

PDB Compounds: (A:) biphenyl dioxygenase large subunit

SCOPe Domain Sequences for d1ulia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulia1 b.33.1.2 (A:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. RHA1 [TaxId: 101510]}
wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym
gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf
eeqafpglrkedwgplqarvetykglifanwdad

SCOPe Domain Coordinates for d1ulia1:

Click to download the PDB-style file with coordinates for d1ulia1.
(The format of our PDB-style files is described here.)

Timeline for d1ulia1: