Lineage for d1ukvy_ (1ukv Y:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582084Protein GTPase Ytp1 [110544] (1 species)
  7. 582085Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110545] (1 PDB entry)
  8. 582086Domain d1ukvy_: 1ukv Y: [107918]
    Other proteins in same PDB: d1ukvg1, d1ukvg2, d1ukvg3
    complexed with gdp, ger, mg

Details for d1ukvy_

PDB Entry: 1ukv (more details), 1.5 Å

PDB Description: Structure of RabGDP-dissociation inhibitor in complex with prenylated YPT1 GTPase

SCOP Domain Sequences for d1ukvy_:

Sequence, based on SEQRES records: (download)

>d1ukvy_ c.37.1.8 (Y:) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae)}
seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw
dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk
cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlnett
qkkedkgnvnlkgqsltntgggcc

Sequence, based on observed residues (ATOM records): (download)

>d1ukvy_ c.37.1.8 (Y:) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae)}
seydylfklllignsgvgksclllrfsddtytndyistigvdfkiktveldgktvklqiw
dtagqerfrtitssyyrgshgiiivydvtdqesfngvkmwlqeidryatstvlkllvgnk
cdlkdkrvveydvakefadankmpfletsaldstnvedafltmarqikesmsqqnlnett
qkkedkgnvnlkgqslc

SCOP Domain Coordinates for d1ukvy_:

Click to download the PDB-style file with coordinates for d1ukvy_.
(The format of our PDB-style files is described here.)

Timeline for d1ukvy_: