Lineage for d1uk1b1 (1uk1 B:662-798)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998271Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 1998272Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 1998273Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 1998274Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 1998283Species Human (Homo sapiens) [TaxId:9606] [101198] (8 PDB entries)
    Uniprot P09874 661-1010
  8. 1998291Domain d1uk1b1: 1uk1 B:662-798 [107903]
    Other proteins in same PDB: d1uk1a2, d1uk1b2
    complexed with frq

Details for d1uk1b1

PDB Entry: 1uk1 (more details), 3 Å

PDB Description: Crystal structure of human poly(ADP-ribose) polymerase complexed with a potent inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase-1

SCOPe Domain Sequences for d1uk1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uk1b1 a.41.1.1 (B:662-798) Domain of poly(ADP-ribose) polymerase {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyeklk

SCOPe Domain Coordinates for d1uk1b1:

Click to download the PDB-style file with coordinates for d1uk1b1.
(The format of our PDB-style files is described here.)

Timeline for d1uk1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uk1b2