SCOP 1.73: Domain d1uj3c2: 1uj3 C:707-810

Lineage for d1uj3c2 (1uj3 C:707-810)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)

8. Domain d1uj3c2: 1uj3 C:707-810 [107893]
   Other proteins in same PDB: d1uj3a1, d1uj3a2, d1uj3b1, d1uj3b2

Details for d1uj3c2

PDB Entry: 1uj3, 2.1 Å

PDB Description: crystal structure of a humanized fab fragment of anti-tissue-factor antibody in complex with tissue factor

PDB Compounds: (C:) tissue factor

SCOP Domain Sequences for d1uj3c2:

Sequence; same for both SEQRES and ATOM records:

>d1uj3c2 b.1.2.1 (C:707-810) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Timeline for d1uj3c2:

• d1uj3c2 first appeared in SCOP 1.69
  
• d1uj3c2 appears in SCOP 1.71
  
• d1uj3c2 appears in SCOP 1.75
  
• d1uj3c2 appears in the current release, SCOPe 2.08