SCOP 1.69: Domain d1uj3b2: 1uj3 B:418-517

Lineage for d1uj3b2 (1uj3 B:418-517)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1uj3b2: 1uj3 B:418-517 [107891]
   Other proteins in same PDB: d1uj3a1, d1uj3a2, d1uj3b1, d1uj3c1, d1uj3c2

Details for d1uj3b2

PDB Entry: 1uj3, 2.1 Å

PDB Description: crystal structure of a humanized fab fragment of anti-tissue-factor antibody in complex with tissue factor

SCOP Domain Sequences for d1uj3b2:

Sequence; same for both SEQRES and ATOM records:

>d1uj3b2 b.1.1.2 (B:418-517) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrves

Timeline for d1uj3b2:

• d1uj3b2 is new in SCOP 1.69
  
• d1uj3b2 appears in SCOP 1.71
  
• d1uj3b2 appears in the current release, SCOPe 2.08