Lineage for d1uikc1 (1uik C:148-350)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567256Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 567257Superfamily b.82.1: RmlC-like cupins [51182] (16 families) (S)
  5. 567289Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 567308Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 567368Species Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId:3847] [110313] (1 PDB entry)
  8. 567373Domain d1uikc1: 1uik C:148-350 [107882]

Details for d1uikc1

PDB Entry: 1uik (more details), 2.3 Å

PDB Description: Crystal structure of soybean beta-conglycinin alpha prime homotrimer

SCOP Domain Sequences for d1uikc1:

Sequence, based on SEQRES records: (download)

>d1uikc1 b.82.1.2 (C:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit}
npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgreegqqqgeerlqe
sviveiskkqirelskhaksssr

Sequence, based on observed residues (ATOM records): (download)

>d1uikc1 b.82.1.2 (C:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit}
npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgqesviveiskkqir
elskhaksssr

SCOP Domain Coordinates for d1uikc1:

Click to download the PDB-style file with coordinates for d1uikc1.
(The format of our PDB-style files is described here.)

Timeline for d1uikc1: