Class b: All beta proteins [48724] (165 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (20 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) |
Protein Seed storage 7S protein [51188] (6 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
Species Soybean (Glycine max), beta-conglycinin beta subunit [TaxId:3847] [109608] (3 PDB entries) |
Domain d1uijf1: 1uij F:6-175 [107876] |
PDB Entry: 1uij (more details), 2.5 Å
SCOP Domain Sequences for d1uijf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uijf1 b.82.1.2 (F:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} dennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillph hadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmiwl aipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfg
Timeline for d1uijf1: