SCOP 1.75: Domain d1uijd2: 1uij D:183-392

Lineage for d1uijd2 (1uij D:183-392)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)

Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology

Superfamily b.82.1: RmlC-like cupins [51182] (24 families)
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
Protein Seed storage 7S protein [51188] (6 species)
duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
Species Soybean (Glycine max), beta-conglycinin beta subunit [TaxId:3847] [109608] (3 PDB entries)
Uniprot P25974
Domain d1uijd2: 1uij D:183-392 [107873]

Details for d1uijd2

PDB Entry: 1uij (more details), 2.5 Å

PDB Description: crystal structure of soybean beta-conglycinin beta homotrimer (i122m/k124w)

PDB Compounds: (D:) beta subunit of beta conglycinin

SCOP Domain Sequences for d1uijd2:

Sequence, based on SEQRES records: (download)

>d1uijd2 b.82.1.2 (D:183-392) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}
qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp
qlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeeepl
evqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqie
rqvqelafpgsaqdverllkkqresyfvda

Sequence, based on observed residues (ATOM records): (download)

>d1uijd2 b.82.1.2 (D:183-392) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]}
qegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknp
qlrdldiflssvdinegalllphfnskaivilvinegdanielvgiklevqryraelsed
dvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsa
qdverllkkqresyfvda

SCOP Domain Coordinates for d1uijd2:

Click to download the PDB-style file with coordinates for d1uijd2.
(The format of our PDB-style files is described here.)

Timeline for d1uijd2: