SCOPe 2.01: Domain d1ugna1: 1ugn A:2-97

Lineage for d1ugna1 (1ugn A:2-97)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [49207] (5 PDB entries)
   Uniprot Q8NHL6 25-218

8. Domain d1ugna1: 1ugn A:2-97 [107828]

Details for d1ugna1

PDB Entry: 1ugn, 1.8 Å

PDB Description: crystal structure of lir1.02, one of the alleles of lir1

PDB Compounds: (A:) leukocyte immunoglobulin-like receptor 1

SCOPe Domain Sequences for d1ugna1:

Sequence; same for both SEQRES and ATOM records:

>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
hlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqfp
ipsitwehtgryrcyygsdtagrsessdplelvvtg

Timeline for d1ugna1:

• d1ugna1 first appeared in SCOP 1.69
  
• d1ugna1 appears in SCOP 1.75
  
• d1ugna1 appears in SCOPe 2.02
  
• d1ugna1 appears in the current release, SCOPe 2.08