Lineage for d1ufpa_ (1ufp A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903195Protein Myoglobin [46469] (9 species)
  7. 903301Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (225 PDB entries)
    Uniprot P02185
  8. 903515Domain d1ufpa_: 1ufp A: [107818]
    complexed with po4

Details for d1ufpa_

PDB Entry: 1ufp (more details), 2.1 Å

PDB Description: crystal structure of an artificial metalloprotein:fe(iii)(3,3'-me2- salophen)/apo-wild type myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1ufpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufpa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d1ufpa_:

Click to download the PDB-style file with coordinates for d1ufpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ufpa_: