Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
Protein Cambialistic superoxide dismutase [54732] (2 species) active with either fe or mn |
Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries) |
Domain d1uerc2: 1uer C:495-581 [107795] Other proteins in same PDB: d1uera1, d1uerb1, d1uerc1, d1uerd1 |
PDB Entry: 1uer (more details), 1.6 Å
SCOP Domain Sequences for d1uerc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uerc2 d.44.1.1 (C:495-581) Cambialistic superoxide dismutase {Porphyromonas gingivalis} eaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagnpvrkglnpll gfdvwehayyltyqnrradhlkdlwsi
Timeline for d1uerc2: