Lineage for d1uefa1 (1uef A:5-108)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071257Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2071276Protein Docking protein 1, Dok1 [101834] (1 species)
  7. 2071277Species Mouse (Mus musculus) [TaxId:10090] [101835] (2 PDB entries)
    Uniprot P97465 152-254
  8. 2071280Domain d1uefa1: 1uef A:5-108 [107788]
    Other proteins in same PDB: d1uefa2

Details for d1uefa1

PDB Entry: 1uef (more details), 2.5 Å

PDB Description: Crystal Structure of Dok1 PTB Domain Complex
PDB Compounds: (A:) Docking protein 1

SCOPe Domain Sequences for d1uefa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uefa1 b.55.1.2 (A:5-108) Docking protein 1, Dok1 {Mouse (Mus musculus) [TaxId: 10090]}
gsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrrygr
dkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaq

SCOPe Domain Coordinates for d1uefa1:

Click to download the PDB-style file with coordinates for d1uefa1.
(The format of our PDB-style files is described here.)

Timeline for d1uefa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uefa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1uefb_