SCOPe 2.04: Domain d1uc6a_: 1uc6 A:

Lineage for d1uc6a_ (1uc6 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Ciliary neurotrophic factor receptor alpha [110060] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110061] (1 PDB entry)
   Uniprot P26992 202-305

8. Domain d1uc6a_: 1uc6 A: [107766]

Details for d1uc6a_

PDB Entry: 1uc6

PDB Description: solution structure of the carboxyl terminal domain of the ciliary neurotrophic factor receptor

PDB Compounds: (A:) Ciliary Neurotrophic Factor Receptor alpha

SCOPe Domain Sequences for d1uc6a_:

Sequence; same for both SEQRES and ATOM records:

>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
gplgsvkpdppenvvarpvpsnprrlevtwqtpstwpdpesfplkfflryrplildqwqh
velsngtahtitdayagkeyiiqvaakdneigtwsdwsvaahatpwtee

Timeline for d1uc6a_:

• d1uc6a_ first appeared in SCOP 1.69
  
• d1uc6a_ appears in SCOPe 2.03
  
• d1uc6a_ appears in SCOPe 2.05
  
• d1uc6a_ appears in the current release, SCOPe 2.08, called d1uc6a1