Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Bacterial alpha-amylase [51447] (10 species) |
Species Bacillus subtilis [TaxId:1423] [51450] (2 PDB entries) Uniprot P00691 |
Domain d1ua7a2: 1ua7 A:4-347 [107760] Other proteins in same PDB: d1ua7a1 complexed with ca |
PDB Entry: 1ua7 (more details), 2.21 Å
SCOPe Domain Sequences for d1ua7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} psiksgtilhawnwsfntlkhnmkdihdagytaiqtspinqvkegnqgdksmsnwywlyq ptsyqignrylgteqefkemcaaaeeygikvivdavinhttfdyaaisnevksipnwthg ntqiknwsdrwdvtqnsllglydwntqntqvqsylkrfleralndgadgfrfdaakhiel pddgsygsqfwpnitntsaefqygeilqdsasrdaayanymdvtasnyghsirsalknrn lgvsnishyasdvsadklvtwveshdtyanddeestwmsdddirlgwaviasrsgstplf fsrpegggngvrfpgksqigdrgsalfedqaitavnrfhnvmag
Timeline for d1ua7a2: