Lineage for d1u7va_ (1u7v A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117952Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1117953Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1117954Family b.26.1.1: SMAD domain [49880] (4 proteins)
  6. 1117961Protein Smad2 MH2 domain [49883] (1 species)
  7. 1117962Species Human (Homo sapiens) [TaxId:9606] [49884] (3 PDB entries)
  8. 1117966Domain d1u7va_: 1u7v A: [107729]
    Other proteins in same PDB: d1u7vb_

Details for d1u7va_

PDB Entry: 1u7v (more details), 2.7 Å

PDB Description: Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex
PDB Compounds: (A:) Mothers against decapentaplegic homolog 2

SCOPe Domain Sequences for d1u7va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7va_ b.26.1.1 (A:) Smad2 MH2 domain {Human (Homo sapiens) [TaxId: 9606]}
epafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatvemtr
rhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqe
faallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwl
dkvltqmgspsvrcssms

SCOPe Domain Coordinates for d1u7va_:

Click to download the PDB-style file with coordinates for d1u7va_.
(The format of our PDB-style files is described here.)

Timeline for d1u7va_: