Lineage for d1u7ib_ (1u7i B:)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (8 families) 
Family d.32.1.7: 3-demethylubiquinone-9 3-methyltransferase (Pfam 06983) [110883] (2 proteins) Protein Hypothetical protein PA1358 [110884] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [110885] (1 PDB entry) 
Domain d1u7ib_: 1u7i B: [107725]
Structural genomics target
Details for d1u7ib_
PDB Entry: 1u7i (more details), 1.4 Å
PDB Description: Crystal Structure of Protein of Unknown Function PA1358 from Pseudomonas aeruginosa
SCOP Domain Sequences for d1u7ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u7ib_ d.32.1.7 (B:) Hypothetical protein PA1358 {Pseudomonas aeruginosa}
msarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgdqs
vhcidshvrhafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfawla
drfgvswqlnlag
SCOP Domain Coordinates for d1u7ib_:
Click to download the PDB-style file with coordinates for d1u7ib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u7ib_:
- d1u7ib_ is new in SCOP 1.69
- d1u7ib_ appears in SCOP 1.71
- d1u7ib_ appears in the current release, SCOPe 2.08, called d1u7ib1
View in 3D
