SCOP 1.69: Domain d1u78a1: 1u78 A:2-54

Lineage for d1u78a1 (1u78 A:2-54)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.2: Recombinase DNA-binding domain [46728] (5 proteins)

6. Protein Transposase tc3a1-65 [46733] (1 species)

7. Species Caenorhabditis elegans [46734] (2 PDB entries)

8. Domain d1u78a1: 1u78 A:2-54 [107712]

Details for d1u78a1

PDB Entry: 1u78, 2.69 Å

PDB Description: structure of the bipartite dna-binding domain of tc3 transposase bound to transposon dna

SCOP Domain Sequences for d1u78a1:

Sequence; same for both SEQRES and ATOM records:

>d1u78a1 a.4.1.2 (A:2-54) Transposase tc3a1-65 {Caenorhabditis elegans}
prgsalsdteraqldvmkllnvslhemsrkisrsrhcirvylkdpvsygtskr

Timeline for d1u78a1:

• d1u78a1 is new in SCOP 1.69
  
• d1u78a1 appears in SCOP 1.71
  
• d1u78a1 appears in the current release, SCOPe 2.08