Class a: All alpha proteins [46456] (285 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Mitochondrial cytochrome c [46642] (6 species) |
Species Horse (Equus caballus) [TaxId:9796] [46644] (22 PDB entries) Uniprot P00004 |
Domain d1u75b_: 1u75 B: [107709] Other proteins in same PDB: d1u75a_, d1u75c_ complexed with hem, po4, znh |
PDB Entry: 1u75 (more details), 2.55 Å
SCOPe Domain Sequences for d1u75b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u75b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Horse (Equus caballus) [TaxId: 9796]} gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgftytdanknkgitwk eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne
Timeline for d1u75b_: