SCOP 1.75: Domain d1u74d_: 1u74 D:

Lineage for d1u74d_ (1u74 D:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (43 PDB entries)
   Uniprot P00044

8. Domain d1u74d_: 1u74 D: [107707]
   Other proteins in same PDB: d1u74a_, d1u74c_
   complexed with hem, po4, znh; mutant

Details for d1u74d_

PDB Entry: 1u74, 2.4 Å

PDB Description: electron transfer complex between cytochrome c and cytochrome c peroxidase

PDB Compounds: (D:) Cytochrome c iso-1

SCOP Domain Sequences for d1u74d_:

Sequence; same for both SEQRES and ATOM records:

>d1u74d_ a.3.1.1 (D:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase

Timeline for d1u74d_:

• d1u74d_ first appeared in SCOP 1.69
  
• d1u74d_ appears in SCOP 1.73
  
• d1u74d_ appears in SCOPe 2.01
  
• d1u74d_ appears in the current release, SCOPe 2.08