Lineage for d1u74b_ (1u74 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691036Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2691040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries)
    Uniprot P00044
  8. 2691122Domain d1u74b_: 1u74 B: [107705]
    Other proteins in same PDB: d1u74a_, d1u74c1, d1u74c2
    complexed with hem, po4, znh

Details for d1u74b_

PDB Entry: 1u74 (more details), 2.4 Å

PDB Description: electron transfer complex between cytochrome c and cytochrome c peroxidase
PDB Compounds: (B:) Cytochrome c iso-1

SCOPe Domain Sequences for d1u74b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u74b_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkase

SCOPe Domain Coordinates for d1u74b_:

Click to download the PDB-style file with coordinates for d1u74b_.
(The format of our PDB-style files is described here.)

Timeline for d1u74b_: