SCOP 1.69: Domain d1u67a2: 1u67 A:32-73

Lineage for d1u67a2 (1u67 A:32-73)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (21 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (17 PDB entries)

8. Domain d1u67a2: 1u67 A:32-73 [107698]
   Other proteins in same PDB: d1u67a1

Details for d1u67a2

PDB Entry: 1u67, 3.1 Å

PDB Description: crystal structure of arachidonic acid bound to a mutant of prostagladin h synthase-1 that forms predominantly 11-hpete.

SCOP Domain Sequences for d1u67a2:

Sequence; same for both SEQRES and ATOM records:

>d1u67a2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d1u67a2:

• d1u67a2 is new in SCOP 1.69
  
• d1u67a2 appears in SCOP 1.71
  
• d1u67a2 appears in the current release, SCOPe 2.08