Lineage for d1u46b_ (1u46 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1433676Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species)
    PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinase
  7. 1433677Species Human (Homo sapiens) [TaxId:9606] [111201] (7 PDB entries)
    Uniprot Q07912 117-389
  8. 1433681Domain d1u46b_: 1u46 B: [107657]
    complexed with cl

Details for d1u46b_

PDB Entry: 1u46 (more details), 2 Å

PDB Description: Crystal Structure of the Unphosphorylated Kinase Domain of the Tyrosine Kinase ACK1
PDB Compounds: (B:) Activated CDC42 kinase 1

SCOPe Domain Sequences for d1u46b_:

Sequence, based on SEQRES records: (download)

>d1u46b_ d.144.1.7 (B:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir
evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv
aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw
capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc
pqdiynvmvqcwahkpedrptfvalrdflleaqp

Sequence, based on observed residues (ATOM records): (download)

>d1u46b_ d.144.1.7 (B:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]}
ltcligekdlrlleklggvvrrgewdapsgktvsvavkcmddfirevnamhsldhrnlir
lygvvltppmkmvtelaplgslldrlrkhqgllgtlsryavqvaegmgyleskrfihrdl
aarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfawcapeslktrtfshasdt
wmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvqcwahkpe
drptfvalrdflleaqp

SCOPe Domain Coordinates for d1u46b_:

Click to download the PDB-style file with coordinates for d1u46b_.
(The format of our PDB-style files is described here.)

Timeline for d1u46b_: