SCOP 1.73: Domain d1u3ja_: 1u3j A:

Lineage for d1u3ja_ (1u3j A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49249] (8 PDB entries)

8. Domain d1u3ja_: 1u3j A: [107642]
   mutant

Details for d1u3ja_

PDB Entry: 1u3j, 1.9 Å

PDB Description: crystal structure of mlav mutant of dimerisation domain of nf-kb p50 transcription factor

PDB Compounds: (A:) Nuclear factor NF-kappa-B p105 subunit

SCOP Domain Sequences for d1u3ja_:

Sequence, based on SEQRES records:

>d1u3ja_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
nlkivrmdrtagcvtggeeimllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq
faivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Sequence, based on observed residues (ATOM records):

>d1u3ja_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]}
nlkivrmdrtagcvtggeeimllcdkvqkddiqirfyeevwegfgdfsptdvhrqfaivf
ktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d1u3ja_:

• d1u3ja_ first appeared in SCOP 1.69
  
• d1u3ja_ appears in SCOP 1.71
  
• d1u3ja_ appears in SCOP 1.75
  
• d1u3ja_ appears in the current release, SCOPe 2.08