![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins) subgroup of the larger IPT/TIG domain family |
![]() | Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49249] (8 PDB entries) |
![]() | Domain d1u3ja_: 1u3j A: [107642] mutant |
PDB Entry: 1u3j (more details), 1.9 Å
SCOP Domain Sequences for d1u3ja_:
Sequence, based on SEQRES records: (download)
>d1u3ja_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]} nlkivrmdrtagcvtggeeimllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrq faivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype
>d1u3ja_ b.1.18.1 (A:) p50 subunit of NF-kappa B transcription factor {Human (Homo sapiens) [TaxId: 9606]} nlkivrmdrtagcvtggeeimllcdkvqkddiqirfyeevwegfgdfsptdvhrqfaivf ktpkykdvnitkpasvfvqlrrksdletsepkpflyype
Timeline for d1u3ja_: