Lineage for d1u2ra5 (1u2r A:726-842)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604341Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 604342Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 604343Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 604344Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (3 PDB entries)
  8. 604352Domain d1u2ra5: 1u2r A:726-842 [107621]
    Other proteins in same PDB: d1u2ra1, d1u2ra2, d1u2ra3
    complexed with apr, dde, gdp, mg, so1

Details for d1u2ra5

PDB Entry: 1u2r (more details), 2.6 Å

PDB Description: Crystal Structure of ADP-ribosylated Ribosomal Translocase from Saccharomyces cerevisiae

SCOP Domain Sequences for d1u2ra5:

Sequence, based on SEQRES records: (download)

>d1u2ra5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae)}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Sequence, based on observed residues (ATOM records): (download)

>d1u2ra5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae)}
epvflveiqcpeqavggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqat
ggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOP Domain Coordinates for d1u2ra5:

Click to download the PDB-style file with coordinates for d1u2ra5.
(The format of our PDB-style files is described here.)

Timeline for d1u2ra5: